PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_21320_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 115aa    MW: 13268.8 Da    PI: 8.7816
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_21320_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.4e-4132108177
                                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------- CS
                                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrr 74 
                                          +Cqve+C+  l+eak yhrrhkvCe+hskapvv +sg+ qrfCqqCsrfh+lsefDe+krsCrrrLa+hnerrr
  cra_locus_21320_iso_3_len_941_ver_3  32 CCQVEDCQISLKEAKPYHRRHKVCEHHSKAPVVQMSGHPQRFCQQCSRFHDLSEFDEAKRSCRRRLAGHNERRR 105
                                          6************************************************************************* PP

                                          S-- CS
                                  SBP  75 kkq 77 
                                          k++
  cra_locus_21320_iso_3_len_941_ver_3 106 KSS 108
                                          *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-342694IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.67630107IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.06E-3831112IPR004333Transcription factor, SBP-box
PfamPF031103.0E-3333106IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
DEDVEEENNK KKRALTLSGR RVTCAAGSTQ PCCQVEDCQI SLKEAKPYHR RHKVCEHHSK  60
APVVQMSGHP QRFCQQCSRF HDLSEFDEAK RSCRRRLAGH NERRRKSSYD SLGEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-35331061184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096328.11e-49PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387416e-50SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A068TTY61e-55A0A068TTY6_COFCA; Squamosa promoter-binding-like protein
STRINGSolyc02g077920.2.11e-47(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105